Return to main results Retrieve Phyre Job Id

Job DescriptionP00968
Confidence89.19%DateThu Jan 5 10:57:25 GMT 2012
Rank493Aligned Residues32
% Identity31%Templatec1m6iA_
PDB info PDB header:oxidoreductaseChain: A: PDB Molecule:programmed cell death protein 8; PDBTitle: crystal structure of apoptosis inducing factor (aif)
Resolution1.80 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   910.........20.........30.........40.. .......50.
Predicted Secondary structure 















..


Query SS confidence 

































. .








Query Sequence  SILILGAGPIVIGQACEFDYSGAQACKALREEGY. . RVILVNSNP
Query Conservation 







 
 

 
 


 

 







 

.. 



  

Alig confidence 







...........














..








Template Conservation 







........... 


 

  
   
    
 


   
Template Sequence  PFLLIGGG. . . . . . . . . . . TAAFAAARSIRARDPGARVLIVSEDP
Template Known Secondary structure  S
S...........STT
SSS
Template Predicted Secondary structure 



...........







Template SS confidence 












































   133......140 .........150.........160......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions