Return to main results Retrieve Phyre Job Id

Job DescriptionP00968
Confidence91.54%DateThu Jan 5 10:57:25 GMT 2012
Rank349Aligned Residues33
% Identity21%Templatec1geuA_
PDB info PDB header:oxidoreductase(flavoenzyme)Chain: A: PDB Molecule:glutathione reductase; PDBTitle: anatomy of an engineered nad-binding site
Resolution2.20 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   8. 10.........20.........30.........40.........50.
Predicted Secondary structure 
..


















Query SS confidence 

. .









































Query Sequence  KS. . ILILGAGPIVIGQACEFDYSGAQACKALREEGYRVILVNSNP
Query Conservation 

..






 
 

 
 


 

 







 

 



  

Alig confidence 

..






...........























Template Conservation 
 








........... 


 

  
   
  
 



  
Template Sequence  KHYDYIAIGGG. . . . . . . . . . . SGGIASINRAAMYGQKCALIEAKE
Template Known Secondary structure 


S...........TTT

SS
Template Predicted Secondary structure 





...........





Template SS confidence 













































   3......10... ......20.........30.......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions