Return to main results Retrieve Phyre Job Id

Job DescriptionP76220
Confidence9.71%DateThu Jan 5 12:20:44 GMT 2012
Rank40Aligned Residues46
% Identity28%Templatec3dsoA_
PDB info PDB header:metal binding proteinChain: A: PDB Molecule:putative uncharacterized protein copk; PDBTitle: crystal structure of cu(i) bound copper resistance protein copk
Resolution1.55 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   62.......70.........80.........90.........100.........110........ .120.........130.
Predicted Secondary structure 


























.







Query SS confidence 
























































.












Query Sequence  QINGRFLTDDTRHGIVFKDGSNGHKSLFMGYATPKAFYEALKEAGGTPGENMTMDNK. ETTHVTGSKLDIS
Query Conservation   

 
  

 
 
 

 
 
 
 




   
 
  
  


 



 
     
  .    





 

Alig confidence 




..





..










....................










.












Template Conservation 

 

..



  ..









 ....................
 

   
  
  


 

  
 
 
Template Sequence  TYDLQ. . DGSKVH. . VFKDGKMGMEN. . . . . . . . . . . . . . . . . . . . KFGKSMNMPEGKVMETRDGTKIIMK
Template Known Secondary structure  BT..TS
..TTS

....................TTS



TT

BTTS
Template Predicted Secondary structure 
..


..




....................













Template SS confidence 






































































   910... ...... 20.........30 .........40.........50.....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions