Return to main results Retrieve Phyre Job Id

Job DescriptionP0A8L5
Confidence10.71%DateThu Jan 5 11:08:07 GMT 2012
Rank8Aligned Residues31
% Identity39%Templatec3u1xA_
PDB info PDB header:hydrolaseChain: A: PDB Molecule:putative glycosyl hydrolase; PDBTitle: crystal structure of a putative glycosyl hydrolase (bdi_1869) from2 parabacteroides distasonis atcc 8503 at 1.70 a resolution
Resolution1.70 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   80.........90.........100.........110........
Predicted Secondary structure 





























Query SS confidence 






































Query Sequence  KLTRENLPTFEWLPMTCAYRLLAEGKDLPAWHPLLTGSK
Query Conservation   

        


 






 


 

 






  
Alig confidence 








........





















Template Conservation    
      ........
   






 

        
Template Sequence  VLTEEEKAE. . . . . . . . GYTLLFNGKDFTGWKXFNGGDV
Template Known Secondary structure 


T........TSS
SSS
TTTTSSS
Template Predicted Secondary structure 



........















Template SS confidence 






































   33......40. ........50.........60...
 
Download:Text version FASTA pairwise alignment 3D Model in PDB format

View in Jmol

Send structure to FirstGlance for more viewing options


Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions