Return to main results Retrieve Phyre Job Id

Job DescriptionP21338
Confidence2.52%DateThu Jan 5 11:38:03 GMT 2012
Rank98Aligned Residues38
% Identity21%Templatec3lqbA_
PDB info PDB header:hydrolaseChain: A: PDB Molecule:loc792177 protein; PDBTitle: crystal structure of the hatching enzyme zhe1 from the zebrafish danio2 rerio
Resolution1.10 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   80........ .90.........100.........110.........120.........130.........140.........150.......
Predicted Secondary structure 







..












































Query SS confidence 








. .




































































Query Sequence  LWPGLPKSV. . AARGVDERRWMRFGCATRPIPNLPEARASRMCSSPETGLSLETAAKLSEVMPGAGGRSCLERYEYAKHG
Query Conservation 


    
 ..              
                       
       
   

       

 


 


Alig confidence 








..





..............................














...........





.
Template Conservation   

      
 


 
 ..............................          
  

...........  
   .
Template Sequence  FWKKNANNIVEVPYVVS. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . GEFSINDKSVIANAI. . . . . . . . . . . SIFHAQ.
Template Known Secondary structure  S

B
TTS

..............................TTS
............
Template Predicted Secondary structure 









..............................



............
Template SS confidence 















































































   11........20....... ..30.........40.. ......
 
   158.
Predicted Secondary structure 

Query SS confidence 

Query Sequence  AC
Query Conservation 

Alig confidence 

Template Conservation 

Template Sequence  TC
Template Known Secondary structure  SS
Template Predicted Secondary structure 

Template SS confidence 

   4950
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions