Return to main results Retrieve Phyre Job Id

Job DescriptionP21338
Confidence9.26%DateThu Jan 5 11:38:03 GMT 2012
Rank23Aligned Residues28
% Identity7%Templatec2cfaB_
PDB info PDB header:transferaseChain: B: PDB Molecule:thymidylate synthase; PDBTitle: structure of viral flavin-dependant thymidylate synthase2 thyx
Resolution2.3 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   151........160... ......170........
Predicted Secondary structure 







........
Query SS confidence 












. . . . . . . .














Query Sequence  YEYAKHGACFGFD. . . . . . . . PDAYFGTMVRLNQEI
Query Conservation 


 




    ........   

  

 
    
Alig confidence 












........














Template Conservation   

 


  
  
 
 

          
   
  
Template Sequence  AQVIRHRSFHFQEFSPWWATEQEKLYAQSMELYNKA
Template Known Secondary structure  TT
TTS



Template Predicted Secondary structure 


Template SS confidence 



































   74.....80.........90.........100.........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions