Return to main results Retrieve Phyre Job Id

Job DescriptionP21338
Confidence2.79%DateThu Jan 5 11:38:03 GMT 2012
Rank81Aligned Residues48
% Identity17%Templatec1o8tA_
PDB info PDB header:lipid transportChain: A: PDB Molecule:apolipoprotein c-ii; PDBTitle: global structure and dynamics of human apolipoprotein cii2 in complex with micelles: evidence for increased mobility3 of the helix involvved in the activation of lipoprotein4 lipase.
ResolutionUNK

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   117..120.........130.........140.........150.........160.........170.........180.........
Predicted Secondary structure 




























Query SS confidence 








































































Query Sequence  SRMCSSPETGLSLETAAKLSEVMPGAGGRSCLERYEYAKHGACFGFDPDAYFGTMVRLNQEIKESEAGKFLAD
Query Conservation            
       
   

       

 


 




       

  

 
    
          
Alig confidence 


























.........................




















Template Conservation 
  
   


 

 

 

 


 


.........................  
  



   
  





Template Sequence  PQQDEMPSPTFLTQVKESLSSYWESAK. . . . . . . . . . . . . . . . . . . . . . . . . TAAQNLYEKTYLPAVDEKLRD
Template Known Secondary structure 

SSSS

.........................S
Template Predicted Secondary structure 








.........................



Template SS confidence 








































































   4.....10.........20.........30 .........40.........50.
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions