Return to main results Retrieve Phyre Job Id

Job DescriptionP0AGA6
Confidence79.56%DateThu Jan 5 11:28:37 GMT 2012
Rank380Aligned Residues32
% Identity31%Templatec2wgbB_
PDB info PDB header:transcriptionChain: B: PDB Molecule:tetr family transcriptional repressor lfrr; PDBTitle: crystal structure of the tetr-like transcriptional2 regulator lfrr from mycobacterium smegmatis
Resolution2.00 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   154.....160.........170.........180.........190....
Predicted Secondary structure 









Query SS confidence 








































Query Sequence  AVKEIAAELGLSPKTVHVHRANLMEKLGVSNDVELARRMFD
Query Conservation 
  


  
 

  

  
   
  

 
  
 

   
  
Alig confidence 


















.........












Template Conservation 

  

  



  


  .........
 


 
   
  
Template Sequence  ALGDIAAAAGVGRSTVHRY. . . . . . . . . YPERTDLLRALAR
Template Known Secondary structure 
T

.........
SS
Template Predicted Secondary structure 





.........


Template SS confidence 








































   33......40.........50. ........60....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions