Return to main results Retrieve Phyre Job Id

Job DescriptionP0AGA6
Confidence79.03%DateThu Jan 5 11:28:37 GMT 2012
Rank385Aligned Residues30
% Identity23%Templatec2of7A_
PDB info PDB header:transcriptionChain: A: PDB Molecule:putative tetr-family transcriptional regulator; PDBTitle: structural genomics, the crystal structure of a tetr-family2 transcriptional regulator from streptomyces coelicolor a3
Resolution2.30 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   151........160.........170.........180.........
Predicted Secondary structure 










Query SS confidence 






































Query Sequence  QGMAVKEIAAELGLSPKTVHVHRANLMEKLGVSNDVELA
Query Conservation   
 
  


  
 

  

  
   
  

 
  
 

 
Alig confidence 





















.........







Template Conservation     

  

  



  
 
  .........
 

  

Template Sequence  EATTVEQIAERAEVSPSTVLRY. . . . . . . . . FPTREDIV
Template Known Secondary structure  TT

TS
.........
SS
Template Predicted Secondary structure 






.........


Template SS confidence 






































   44.....50.........60..... ....70...
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions