Return to main results Retrieve Phyre Job Id

Job DescriptionP64524
Confidence3.26%DateThu Jan 5 12:09:10 GMT 2012
Rank95Aligned Residues24
% Identity29%Templatec2kz5A_
PDB info PDB header:transcriptionChain: A: PDB Molecule:transcription factor nf-e2 45 kda subunit; PDBTitle: solution nmr structure of transcription factor nf-e2 subunit's dna2 binding domain from homo sapiens, northeast structural genomics3 consortium target hr4653b
ResolutionUNK

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   42.......50.........60.........70..
Predicted Secondary structure 






Query SS confidence 






























Query Sequence  PFADERVIEQHIEAGISLCDAVNFLVEKYAL
Query Conservation   
 

 

   

 



  


 




 
Alig confidence 








.......














Template Conservation 


 
 

 .......


 


 

    
Template Sequence  PFPTDKIVN. . . . . . . LPVDDFNELLARYPL
Template Known Secondary structure  SS
.......S
S

Template Predicted Secondary structure 


.......




Template SS confidence 






























   34.....40.. .......50.......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions