Return to main results Retrieve Phyre Job Id

Job DescriptionP69801
Confidence14.92%DateThu Jan 5 12:12:01 GMT 2012
Rank7Aligned Residues32
% Identity28%Templated1kqfb2
SCOP infoSingle transmembrane helix Iron-sulfur subunit of formate dehydrogenase N, transmembrane anchor Iron-sulfur subunit of formate dehydrogenase N, transmembrane anchor
Resolution1.60

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   223......230.........240.........250.........260....
Predicted Secondary structure 




















Query SS confidence 









































Query Sequence  NLVALGVIGTVMAVLYIQLSPKYNRVAGAPAQAAGNNDLDNE
Query Conservation    
 




   
 
                        
 
Alig confidence 
























..........






Template Conservation 
 
  

       
 


 



 ..........


    
Template Sequence  PLAAAGFIATFAGLIFHYIGIGPNK. . . . . . . . . . EVDDDEE
Template Known Secondary structure 



..........S
SSTT
Template Predicted Secondary structure 




..........


Template SS confidence 









































   259260.........270.........280... ......290
 
Download:Text version FASTA pairwise alignment 3D Model in PDB format

View in Jmol

Send structure to FirstGlance for more viewing options


Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions