Return to main results Retrieve Phyre Job Id

Job DescriptionQ9S4X1
Confidence4.35%DateThu Jan 5 12:38:24 GMT 2012
Rank18Aligned Residues33
% Identity21%Templatec3txsC_
PDB info PDB header:viral proteinChain: C: PDB Molecule:terminase dna packaging enzyme small subunit; PDBTitle: crystal structure of phage 44rr small terminase gp16
Resolution1.81 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   26...30.........40.........50.........60.......
Predicted Secondary structure 
Query SS confidence 









































Query Sequence  RLNDMEHRCRFDSDVLVERLARQTLYRANRLFMEAYTEILEL
Query Conservation   
   
       
 
 



  

 
   
  

    
 
Alig confidence 









.........






















Template Conservation 
  
 



 ......... 

 
 
 
 

 
 

 



 
Template Sequence  RKIDQDDDYE. . . . . . . . . LVRRNMHYQSQMLLDMAKIALEN
Template Known Secondary structure  .........
Template Predicted Secondary structure 



.........
Template SS confidence 









































   42.......50. ........60.........70....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions