Return to main results Retrieve Phyre Job Id

Job DescriptionP0ADD2
Confidence8.15%DateWed Jan 25 15:20:27 GMT 2012
Rank5Aligned Residues21
% Identity33%Templatec2k1aA_
PDB info PDB header:cell adhesionChain: A: PDB Molecule:integrin alpha-iib; PDBTitle: bicelle-embedded integrin alpha(iib) transmembrane segment
ResolutionUNK

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   135....140........ .150.....
Predicted Secondary structure  .........




Query SS confidence 













. . . . . . . . .






Query Sequence  IVGALSIGLSIPGL. . . . . . . . . WLYRKRP
Query Conservation 
  




      .........   
 
 
Alig confidence 













.........






Template Conservation 





 




  

  


 




 

Template Sequence  VLVGVLGGLLLLTILVLAMWKVGFFKRNRP
Template Known Secondary structure  TTTT




Template Predicted Secondary structure 



Template SS confidence 





























   969970.........980.........990........
 
Download:Text version FASTA pairwise alignment 3D Model in PDB format

View in Jmol

Send structure to FirstGlance for more viewing options


Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions