Return to main results Retrieve Phyre Job Id

Job DescriptionP65294
Confidence2.62%DateThu Jan 5 12:10:11 GMT 2012
Rank66Aligned Residues29
% Identity28%Templatec3nppA_
PDB info PDB header:structural genomics, unknown functionChain: A: PDB Molecule:pfam duf1093 family protein; PDBTitle: crystal structure of a pfam duf1093 family protein (bsu39620) from2 bacillus subtilis at 2.15 a resolution
Resolution2.15 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   24.....30.........40.........50.. .......60..
Predicted Secondary structure 














....




Query SS confidence 




























. . . .









Query Sequence  YVMATKDGRMILTDGKPEIDDDTGLVSYH. . . . DQQGNAMQIN
Query Conservation 




 

  
 
 


  
  

 
 
 ....
  
    

Alig confidence 








..........









....









Template Conservation 
  
     ..........      
 
 
  


 
  
 
 
Template Sequence  YVQIDRDGR. . . . . . . . . . HLSPGGTEYTLDGYNASGKKEEVT
Template Known Secondary structure 

S

..........TTT
TT

Template Predicted Secondary structure 




..........









Template SS confidence 










































   41........ 50.........60.........70...
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions