Return to main results Retrieve Phyre Job Id

Job DescriptionP21888
Confidence21.32%DateThu Jan 5 11:38:38 GMT 2012
Rank160Aligned Residues34
% Identity21%Templated1tvca2
SCOP infoFerredoxin reductase-like, C-terminal NADP-linked domain Ferredoxin reductase-like, C-terminal NADP-linked domain Aromatic dioxygenase reductase-like
ResolutionUNK

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   1920.........30.........40.........50.........60.....
Predicted Secondary structure 



















Query SS confidence 














































Query Sequence  HAGEVGMYVCGITVYDLCHIGHGRTFVAFDVVARYLRFLGYKLKYVR
Query Conservation      
  
 



  
  





  
  




 

  
  
  
 
Alig confidence 











.............





















Template Conservation        
 



.............  
   
   
   

    
 
Template Sequence  SDANPDIYLCGP. . . . . . . . . . . . . PGMIDAACELVRSRGIPGEQVF
Template Known Secondary structure  SSSSSSS.............



S
Template Predicted Secondary structure 






.............



Template SS confidence 














































   208.210......... 220.........230.........240.
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions