Return to main results Retrieve Phyre Job Id

Job DescriptionP21888
Confidence29.79%DateThu Jan 5 11:38:38 GMT 2012
Rank130Aligned Residues33
% Identity18%Templatec3othB_
PDB info PDB header:transferase/antibioticChain: B: PDB Molecule:calg1; PDBTitle: crystal structure of calg1, calicheamicin glycostyltransferase, tdp2 and calicheamicin alpha3i bound form
Resolution2.30 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   25....30.........40.........50.........60......
Predicted Secondary structure 
















Query SS confidence 









































Query Sequence  MYVCGITVYDLCHIGHGRTFVAFDVVARYLRFLGYKLKYVRN
Query Conservation   
 



  
  





  
  




 

  
  
  
  
Alig confidence 






......







...

















Template Conservation 
      ...... 

     ... 

  
  




 
 
 
Template Sequence  LFASLGT. . . . . . HGHTYPLL. . . PLATAARAAGHEVTFATG
Template Known Secondary structure 

SS......GGG...TT

Template Predicted Secondary structure 



......
...



Template SS confidence 









































   4.....10 ........ .20.........30......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions