Return to main results Retrieve Phyre Job Id

Job DescriptionP05055
Confidence31.10%DateThu Jan 5 10:58:40 GMT 2012
Rank202Aligned Residues23
% Identity30%Templatec1egaB_
PDB info PDB header:hydrolaseChain: B: PDB Molecule:protein (gtp-binding protein era); PDBTitle: crystal structure of a widely conserved gtpase era
Resolution2.40 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   568.570......... 580.........590
Predicted Secondary structure 



........

Query SS confidence 











. . . . . . . .










Query Sequence  VIGKGGSVIRAL. . . . . . . . TEETGTTIEIE
Query Conservation 


 


 
  
........   

  
 
 
Alig confidence 











........










Template Conservation 


  
  

 
   
   
       
 
 
Template Sequence  VIGNKGAKIKTIGIEARKDMQEMFEAPVHLE
Template Known Secondary structure 
GGGSSSS
Template Predicted Secondary structure 







Template SS confidence 






























   246...250.........260.........270......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions