Return to main results Retrieve Phyre Job Id

Job DescriptionP64485
Confidence0.71%DateThu Jan 5 12:08:51 GMT 2012
Rank94Aligned Residues47
% Identity17%Templatec3hd6A_
PDB info PDB header:membrane protein, transport proteinChain: A: PDB Molecule:ammonium transporter rh type c; PDBTitle: crystal structure of the human rhesus glycoprotein rhcg
Resolution2.10 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   8.10.........20.........30.........40.........50.........60.........70.......
Predicted Secondary structure 















Query SS confidence 





































































Query Sequence  IFGLIAGILAKWIMPGKDGGGFFMTILLGIVGAVVGGWISTLFGFGKVDGFNFGSFVVAVIGAIVVLFIY
Query Conservation 
 




 


 
 

    
 
 








 


 
    
            
 








 

Alig confidence 




















.......................

























Template Conservation    

  


 
  



  
 .......................          
     


  

 

Template Sequence  TFGAYFGLTVTRILYRRNLEQ. . . . . . . . . . . . . . . . . . . . . . . SKERQNSVYQSDLFAMIGTLFLWMYW
Template Known Secondary structure  T

TTGGG.......................GTTTSS

Template Predicted Secondary structure 






.......................










Template SS confidence 





































































   186...190.........200...... ...210.........220.........230..
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions