Return to main results Retrieve Phyre Job Id

Job DescriptionP0AD53
Confidence3.78%DateThu Jan 5 11:20:02 GMT 2012
Rank39Aligned Residues34
% Identity26%Templatec2zf8A_
PDB info PDB header:structural proteinChain: A: PDB Molecule:component of sodium-driven polar flagellar motor; PDBTitle: crystal structure of moty
Resolution2.85 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   4.....10.........20.........30.........40.......
Predicted Secondary structure 



















Query SS confidence 











































Query Sequence  RPDEVARVLEKVGFTVDVVTQKAYGYRRGENYVYVNREARMGRT
Query Conservation 











































Alig confidence 
























..........








Template Conservation 

  
   
   

   

 
   
..........   
     
Template Sequence  RAESLRDYFQSLGLPEDRIQVQGYG. . . . . . . . . . RVVISLGRT
Template Known Secondary structure  S

TTS


..........




Template Predicted Secondary structure 




..........




Template SS confidence 











































   219220.........230.........240... ......250..
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions