Return to main results Retrieve Phyre Job Id

Job DescriptionP36672
Confidence16.84%DateThu Jan 5 11:53:37 GMT 2012
Rank17Aligned Residues31
% Identity23%Templated2bgwa1
SCOP infoSAM domain-like RuvA domain 2-like Hef domain-like
Resolution2.8

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   7..10.........20.........30.........40.........50....
Predicted Secondary structure 













Query SS confidence 















































Query Sequence  QTDIDRLIELVGGRGNIATVSHCITRLRFVLNQPANARPKEIEQLPMV
Query Conservation     
  
   


  

    

 



  
 
        
     
Alig confidence 

















.................












Template Conservation     
  
   
 
   
 ................. 

 


  
 

Template Sequence  RRTAERILERFGSLERFF. . . . . . . . . . . . . . . . . TASKAEISKVEGI
Template Known Secondary structure  SST.................T

STT
Template Predicted Secondary structure 


.................





Template SS confidence 















































   182.......190......... 200.........210..
 
Download:Text version FASTA pairwise alignment 3D Model in PDB format

View in Jmol

Send structure to FirstGlance for more viewing options


Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions