Return to main results Retrieve Phyre Job Id

Job DescriptionP0AB14
Confidence1.49%DateThu Jan 5 11:14:22 GMT 2012
Rank94Aligned Residues21
% Identity38%Templatec2ffuA_
PDB info PDB header:transferaseChain: A: PDB Molecule:polypeptide n-acetylgalactosaminyltransferase 2; PDBTitle: crystal structure of human ppgalnact-2 complexed with udp2 and ea2
Resolution1.64 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   26...30.........40 ......
Predicted Secondary structure 

..........

Query SS confidence 














. . . . . . . . . .





Query Sequence  EAIFEVAGYDEKMAE. . . . . . . . . . KIWEEG
Query Conservation 














..........





Alig confidence 














..........





Template Conservation    
 






     



 


 


  
Template Sequence  FYFEELGKYDMMMDVWGGENLEISFRVWQCG
Template Known Secondary structure  TT


TT

SSSSTT
Template Predicted Secondary structure 













Template SS confidence 






























   316...320.........330.........340......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions