Return to main results Retrieve Phyre Job Id

Job DescriptionP0AB14
Confidence2.00%DateThu Jan 5 11:14:22 GMT 2012
Rank54Aligned Residues21
% Identity43%Templatec2d7iA_
PDB info PDB header:transferaseChain: A: PDB Molecule:polypeptide n-acetylgalactosaminyltransferase 10; PDBTitle: crsytal structure of pp-galnac-t10 with udp, galnac and mn2+
Resolution2.50 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   26...30........ .40 ......
Predicted Secondary structure 

..........

Query SS confidence 












. . . .

. . . . . .





Query Sequence  EAIFEVAGYDEKM. . . . AE. . . . . . KIWEEG
Query Conservation 












....

......





Alig confidence 












....

......





Template Conservation    
 






    




 


 


  
Template Sequence  KWFWELGGYDPGLEIWGGEQYEISFKVWMCG
Template Known Secondary structure  TTSS
TT

SSSSTT
Template Predicted Secondary structure 













Template SS confidence 






























   327..330.........340.........350.......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions