Return to main results Retrieve Phyre Job Id

Job DescriptionP76228
Confidence14.20%DateWed Jan 25 15:21:06 GMT 2012
Rank10Aligned Residues27
% Identity30%Templatec3cuqA_
PDB info PDB header:protein transportChain: A: PDB Molecule:vacuolar-sorting protein snf8; PDBTitle: integrated structural and functional model of the human escrt-ii2 complex
Resolution2.61 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   94.....100.........110.........120.........130....
Predicted Secondary structure 










Query SS confidence 








































Query Sequence  KKEQLHYYQAKGIEPLSIEKLQALQLIAPYRFYHKQWSETL
Query Conservation     
  
     
     
    
 
        
 
  

Alig confidence 



















..............






Template Conservation 
  
  

 






    ..............   
  
Template Sequence  RVQFQDMCATIGVDPLASGK. . . . . . . . . . . . . . GFWSEML
Template Known Secondary structure  T

TTS
TT..............S
Template Predicted Secondary structure 









..............


Template SS confidence 








































   65....70.........80.... .....90.
 
Download:Text version FASTA pairwise alignment 3D Model in PDB format

View in Jmol

Send structure to FirstGlance for more viewing options


Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions