Return to main results Retrieve Phyre Job Id

Job DescriptionP76228
Confidence13.49%DateWed Jan 25 15:21:06 GMT 2012
Rank11Aligned Residues30
% Identity30%Templatec2zmeA_
PDB info PDB header:protein transportChain: A: PDB Molecule:vacuolar-sorting protein snf8; PDBTitle: integrated structural and functional model of the human escrt-ii2 complex
Resolution2.90 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   94.....100.........110.........120.........130.... ...
Predicted Secondary structure 










...
Query SS confidence 








































. . .


Query Sequence  KKEQLHYYQAKGIEPLSIEKLQALQLIAPYRFYHKQWSETL. . . EFW
Query Conservation     
  
     
     
    
 
        
 
  

...   
Alig confidence 



















..............






...


Template Conservation 
  
  

 






    ..............   
  

 



Template Sequence  RVQFQDMCATIGVDPLASGK. . . . . . . . . . . . . . GFWSEMLGVGDFY
Template Known Secondary structure  T

TTS
TT..............S

Template Predicted Secondary structure 









..............





Template SS confidence 














































   65....70.........80.... .....90.......
 
Download:Text version FASTA pairwise alignment 3D Model in PDB format

View in Jmol

Send structure to FirstGlance for more viewing options


Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions