Return to main results Retrieve Phyre Job Id

Job DescriptionP33228
Confidence2.55%DateThu Jan 5 11:51:27 GMT 2012
Rank52Aligned Residues34
% Identity21%Templatec3op0B_
PDB info PDB header:signaling protein/signaling protein reguChain: B: PDB Molecule:signal transduction protein cbl-c; PDBTitle: crystal structure of cbl-c (cbl-3) tkb domain in complex with egfr2 py1069 peptide
Resolution2.52 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   189190.........200...... ...210... ......220..
Predicted Secondary structure 



.





...........
Query SS confidence 

















.






. . . . . . . . . . .








Query Sequence  MTRKQIELVRSLSKAGNN. GPWVTHW. . . . . . . . . . . EEMAKKTAI
Query Conservation 


 

   
  

    .


   
...........








Alig confidence 

















.






...........








Template Conservation 


  
  

   

   



  
  
   
 
   
  





Template Sequence  LTKAPAHTFWRESCGARCVLPWAEFESLLGTHPVEPGTALALRTTI
Template Known Secondary structure 
SSTT
S







Template Predicted Secondary structure 











Template SS confidence 













































   151........160.........170.........180.........190......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions