Return to main results Retrieve Phyre Job Id

Job DescriptionP33228
Confidence2.03%DateThu Jan 5 11:51:27 GMT 2012
Rank76Aligned Residues27
% Identity22%Templatec2z5bB_
PDB info PDB header:chaperoneChain: B: PDB Molecule:uncharacterized protein ylr021w; PDBTitle: crystal structure of a novel chaperone complex for yeast2 20s proteasome assembly
Resolution1.96 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   8990.........100.........110.........120...
Predicted Secondary structure 

















Query SS confidence 


































Query Sequence  LEPGSALGHAYLLPFGNKNEKSGKKNVQLIIGYRG
Query Conservation 
 
   








 

    
  
 
 





Alig confidence 

















........








Template Conservation     
  

   



 

........


 

 

Template Sequence  LPKENKELYVQATHFNNT. . . . . . . . ILLQIRLNG
Template Known Secondary structure  S





SS
........TT
Template Predicted Secondary structure 







........

Template SS confidence 


































   10.........20....... ..30......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions