Return to main results Retrieve Phyre Job Id

Job DescriptionP33228
Confidence2.78%DateThu Jan 5 11:51:27 GMT 2012
Rank42Aligned Residues24
% Identity25%Templatec1qd6C_
PDB info PDB header:membrane proteinChain: C: PDB Molecule:protein (outer membrane phospholipase (ompla)); PDBTitle: outer membrane phospholipase a from escherichia coli
Resolution2.10 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   99100....... ..110.........120..
Predicted Secondary structure 



............





Query SS confidence 








. . . . . . . . . . . .














Query Sequence  YLLPFGNKN. . . . . . . . . . . . EKSGKKNVQLIIGYR
Query Conservation 




 

 ............   
  
 
 




Alig confidence 








............














Template Conservation 
 

      
                
 






Template Sequence  YLIYTQTSDLNKEAIASYDWAENARKDEVKFQLSLA
Template Known Secondary structure  SS

TTTTTTSGGGGG

S
Template Predicted Secondary structure 



















Template SS confidence 



































   3940.........50.........60.........70....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions