Return to main results Retrieve Phyre Job Id

Job DescriptionP33228
Confidence3.15%DateThu Jan 5 11:51:27 GMT 2012
Rank33Aligned Residues24
% Identity21%Templatec1fw3A_
PDB info PDB header:hydrolase, membrane proteinChain: A: PDB Molecule:outer membrane phospholipase a; PDBTitle: outer membrane phospholipase a from escherichia coli
Resolution2.80 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   99100... ......110.........120..
Predicted Secondary structure  ............









Query SS confidence 




. . . . . . . . . . . .


















Query Sequence  YLLPF. . . . . . . . . . . . GNKNEKSGKKNVQLIIGYR
Query Conservation 




............ 

    
  
 
 




Alig confidence 




............


















Template Conservation 
 

      
                
 






Template Sequence  YLIYTQTSDLNKEAIASYDWAENARKDEVKFQLSLA
Template Known Secondary structure  S


TTTTTTSGGGGG

S
Template Predicted Secondary structure 



















Template SS confidence 



































   3940.........50.........60.........70....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions