Return to main results Retrieve Phyre Job Id

Job DescriptionP0A7H6
Confidence87.53%DateThu Jan 5 11:05:41 GMT 2012
Rank49Aligned Residues34
% Identity29%Templatec2csdB_
PDB info PDB header:isomeraseChain: B: PDB Molecule:topoisomerase v; PDBTitle: crystal structure of topoisomerase v (61 kda fragment)
Resolution2.90 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   11........20.........30.........40... ......50.....
Predicted Secondary structure 






..

Query SS confidence 
































. .











Query Sequence  MEALRCLPGVGPKSAQRMAFTLLQRDRSGGMRL. . AQALTRAMSEIG
Query Conservation 
  
  




 


 


  

         
..
  
      
 
Alig confidence 


















...........


..











Template Conservation 
 













 

...........



 







 


Template Sequence  LAELTKKEGVGRKTAERLL. . . . . . . . . . . RAFGNPERVKQLAREFE
Template Known Secondary structure  STT

SS...........SST
Template Predicted Secondary structure 





...........




Template SS confidence 














































   410.........420........ .430.........440.....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions