Return to main results Retrieve Phyre Job Id

Job DescriptionP0AAT4
Confidence11.71%DateThu Jan 5 11:13:46 GMT 2012
Rank86Aligned Residues23
% Identity26%Templated1g7sa1
SCOP infoReductase/isomerase/elongation factor common domain Translation proteins Elongation factors
Resolution2.00

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   202.......210.........220.........230..
Predicted Secondary structure 









Query SS confidence 






























Query Sequence  LKLGDWLEMPKYGADGAVIDIGLTTVKVRNW
Query Conservation 
 




 
   
  
 








 


 
Alig confidence 








..






......






Template Conservation 
  

 

 ..
   
 
...... 





Template Sequence  LRKDDTIAM. . MTSKDVI. . . . . . STRIRSL
Template Known Secondary structure  TT
..BSSS......

Template Predicted Secondary structure 



..





......
Template SS confidence 






























   258.260...... ...270... ......280
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions