Return to main results Retrieve Phyre Job Id

Job DescriptionP46850
Confidence10.11%DateThu Jan 5 12:04:22 GMT 2012
Rank64Aligned Residues31
% Identity23%Templatec2bh1Y_
PDB info PDB header:transport proteinChain: Y: PDB Molecule:general secretion pathway protein e,; PDBTitle: x-ray structure of the general secretion pathway complex of2 the n-terminal domain of epse and the cytosolic domain of3 epsl of vibrio cholerae
Resolution2.4 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   242.......250.........260.........270.........280.........290.........300....
Predicted Secondary structure 

























Query SS confidence 






























































Query Sequence  FASLNRDAMMENVVTALQSITQKTVRQPQTLAMEEINCHHNYVQKEQHFGEEIYVTRKGAVSA
Query Conservation 

  

  
   
   
                   
  

 
  
   
    






 
Alig confidence 








.........................












.......








Template Conservation 



 



.........................


  
      
.......  
      
Template Sequence  FSFANRFKL. . . . . . . . . . . . . . . . . . . . . . . . . VLDWNEDFSQASI. . . . . . . YYLAPLSME
Template Known Secondary structure  T.........................
TTS
S.......SS

Template Predicted Secondary structure 



.........................




.......



Template SS confidence 






























































   1920....... ..30.........40 .........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions