Return to main results Retrieve Phyre Job Id

Job DescriptionP76154
Confidence17.50%DateThu Jan 5 12:19:46 GMT 2012
Rank9Aligned Residues28
% Identity25%Templatec1wq6A_
PDB info PDB header:oncoproteinChain: A: PDB Molecule:aml1-eto; PDBTitle: the tetramer structure of the nervy homolgy two (nhr2) domain of aml1-2 eto is critical for aml1-eto's activity
Resolution2.00 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   36...40.........50.........60.........70..
Predicted Secondary structure 




Query SS confidence 




































Query Sequence  NTRTLLDYIEGNIKKKSWLDNKELLQTAISVLKDNQN
Query Conservation 





 
      
    
 
   



 

 


 
Alig confidence 

















.........









Template Conservation   
  




  






.........






 
 
Template Sequence  HLDHLLNCIXDXVEKTRR. . . . . . . . . SLTVLRRCQE
Template Known Secondary structure  .........
Template Predicted Secondary structure  .........
Template SS confidence 




































   25....30.........40.. .......50..
 
Download:Text version FASTA pairwise alignment 3D Model in PDB format

View in Jmol

Send structure to FirstGlance for more viewing options


Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions