Return to main results Retrieve Phyre Job Id

Job DescriptionP26612
Confidence96.13%DateThu Jan 5 11:42:59 GMT 2012
Rank185Aligned Residues53
% Identity21%Templatec3u7vA_
PDB info PDB header:hydrolaseChain: A: PDB Molecule:beta-galactosidase; PDBTitle: the structure of a putative beta-galactosidase from caulobacter2 crescentus cb15.
Resolution1.80 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   24.....30.........40.........50.........60.........70.........80.........90.........
Predicted Secondary structure 












































Query SS confidence 











































































Query Sequence  LAERADGFNDIGINMVWLPPAYKGASGGYSVGYDSYDLFDLGEFDQKGSIPTKYGDKAQLLAAIDALKRNDIAVLL
Query Conservation 
  




  


 



 

          

   

           
    

  

  

  

  

 


Alig confidence 















.











...





...................


















Template Conservation 
      


 
 


.   
 
   

 ...

 


...................
 

  
  
   

 


Template Sequence  XAKVWPAIEKVGANTV. QVPIAWEQIEPV. . . EGQFDF. . . . . . . . . . . . . . . . . . . SYLDLLLEQARERKVRLVL
Template Known Secondary structure  T
S.
SB...TTB


...................TT
Template Predicted Secondary structure 



.



...


...................


Template SS confidence 











































































   72.......80....... ..90......... 100..... ....110.........120....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions