Return to main results Retrieve Phyre Job Id

Job DescriptionP26612
Confidence51.64%DateThu Jan 5 11:42:59 GMT 2012
Rank456Aligned Residues64
% Identity16%Templatec3bmaC_
PDB info PDB header:ligaseChain: C: PDB Molecule:d-alanyl-lipoteichoic acid synthetase; PDBTitle: crystal structure of d-alanyl-lipoteichoic acid synthetase from2 streptococcus pneumoniae r6
Resolution2.24 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   11........20.........30.........40.........50.........60.........70.........80.........90
Predicted Secondary structure 


















































Query SS confidence 















































































Query Sequence  HWYYPEGGKLWPELAERADGFNDIGINMVWLPPAYKGASGGYSVGYDSYDLFDLGEFDQKGSIPTKYGDKAQLLAAIDAL
Query Conservation               
  




  


 



 

          

   

           
    

  

  

  
Alig confidence 





....




























......





.................











Template Conservation 
  


....
 





   

    




 



 
......




 ................. 
  
  

 

Template Sequence  YLKSPE. . . . YNDLQLVLTQFSKSKVNPIFIIPPVNKKW. . . . . . MDYAGL. . . . . . . . . . . . . . . . . REDMYQQTVQKI
Template Known Secondary structure 
SS
T....TT




......T
.................
Template Predicted Secondary structure 





....







......

.................
Template SS confidence 















































































   297..300.. .......310.........320.........330. ...... ..340.........
 
   91. .......100.
Predicted Secondary structure  ....


Query SS confidence 

. . . .








Query Sequence  KR. . . . NDIAVLLDV
Query Conservation 
 .... 

 



 
Alig confidence 

....








Template Conservation    

 
 

  
 

Template Sequence  RYQLESQGFTNIADF
Template Known Secondary structure  TTT



Template Predicted Secondary structure 



Template SS confidence 














   350.........360....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions