Return to main results Retrieve Phyre Job Id

Job DescriptionP26612
Confidence92.39%DateThu Jan 5 11:42:59 GMT 2012
Rank233Aligned Residues59
% Identity10%Templatec2p0oA_
PDB info PDB header:structural genomics, unknown functionChain: A: PDB Molecule:hypothetical protein duf871; PDBTitle: crystal structure of a conserved protein from locus ef_2437 in2 enterococcus faecalis with an unknown function
Resolution2.15 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   14.....20.........30.........40.........50.........60.........70.........80.........90...
Predicted Secondary structure 

















































Query SS confidence 















































































Query Sequence  YPEGGKLWPELAERADGFNDIGINMVWLPPAYKGASGGYSVGYDSYDLFDLGEFDQKGSIPTKYGDKAQLLAAIDALKRN
Query Conservation            
  




  


 



 

          

   

           
    

  

  

  

  
Alig confidence 




.






















..




.............................














Template Conservation 
    .  
    

  
   

  



..
 


.............................       
   
   
Template Sequence  FLGEE. ITNDTIIYIKKXKALGFDGIFTS. . LHIPL. . . . . . . . . . . . . . . . . . . . . . . . . . . . . YRQRLTDLGAIAKAE
Template Known Secondary structure 
TTS
.

TT

..



.............................
Template Predicted Secondary structure 



.




..


.............................
Template SS confidence 















































































   7..10. ........20.........30.... ..... 40.........50....
 
   94.....100....
Predicted Secondary structure 


Query SS confidence 










Query Sequence  DIAVLLDVVVN
Query Conservation 

 



 
 
Alig confidence 










Template Conservation     

 



 
Template Sequence  KXKIXVDISGE
Template Known Secondary structure  T

Template Predicted Secondary structure 




Template SS confidence 










   60.........70
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions