Return to main results Retrieve Phyre Job Id

Job DescriptionP26612
Confidence94.61%DateThu Jan 5 11:42:59 GMT 2012
Rank209Aligned Residues55
% Identity9%Templatec1j0yD_
PDB info PDB header:hydrolaseChain: D: PDB Molecule:beta-amylase; PDBTitle: beta-amylase from bacillus cereus var. mycoides in complex2 with glucose
Resolution2.10 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   12.......20.........30.........40..... ....50.........60.........70.........80.......
Predicted Secondary structure 
















....

































Query SS confidence 

































. . . .









































Query Sequence  WYYPEGGKLWPELAERADGFNDIGINMVWLPPAY. . . . KGASGGYSVGYDSYDLFDLGEFDQKGSIPTKYGDKAQLLAAI
Query Conservation              
  




  


 



 

 ....         

   

           
    

  

  

Alig confidence 

.......




















.


....






...





......................



Template Conservation   
....... 
    


 

 



 
 
.

 

 


  

 ...



 
......................
 

Template Sequence  TN. . . . . . . WETFENDLRWAKQNGFYAITV. DFWWGDMEKNGDQQ. . . FDFSYA. . . . . . . . . . . . . . . . . . . . . . QRFA
Template Known Secondary structure  S
.......TT.T
SSTT
...


......................
Template Predicted Secondary structure 

.......



.






...

......................
Template SS confidence 















































































   26. ..30.........40........ .50.........60.. ...... .70..
 
   88.90.........
Predicted Secondary structure 


Query SS confidence 











Query Sequence  DALKRNDIAVLL
Query Conservation    

  

 


Alig confidence 











Template Conservation 


  






Template Sequence  QSVKNAGMKMIP
Template Known Secondary structure  TT
Template Predicted Secondary structure 


Template SS confidence 











   73......80....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions