Return to main results Retrieve Phyre Job Id

Job DescriptionP0A7N1
Confidence10.58%DateThu Jan 5 11:05:58 GMT 2012
Rank33Aligned Residues34
% Identity24%Templatec2b9vB_
PDB info PDB header:hydrolaseChain: B: PDB Molecule:alpha-amino acid ester hydrolase; PDBTitle: acetobacter turbidans alpha-amino acid ester hydrolase
Resolution2.00 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   8.10.........20.........30.........40.........50.......
Predicted Secondary structure 

























Query SS confidence 

















































Query Sequence  EYRTVVFHDTSVDEYFKIGSTIKTDREIELDGVTYPYVTIDVSSKSHPFY
Query Conservation   
  
       
  
 
 

          
   
 
 


 
  



Alig confidence 




















................












Template Conservation      
 
 
         


................


 
  
  
  
Template Sequence  ATLHYHFTLPAVNHVFAKGHR. . . . . . . . . . . . . . . . IMVQIQSSWFPLY
Template Known Secondary structure 





TT
................S

BTTB
Template Predicted Secondary structure 







................






Template SS confidence 

















































   591........600.........610. ........620....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions