Return to main results Retrieve Phyre Job Id

Job DescriptionP64451
Confidence3.40%DateThu Jan 5 12:08:26 GMT 2012
Rank37Aligned Residues48
% Identity19%Templatec2bi0A_
PDB info PDB header:hypothetical proteinChain: A: PDB Molecule:hypothetical protein rv0216; PDBTitle: rv0216, a conserved hypothetical protein from mycobacterium2 tuberculosis that is essential for bacterial survival3 during infection, has a double hotdogfold
Resolution1.9 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   118.120.........130.........140.........150.........160.........170.........180......
Predicted Secondary structure 




























Query SS confidence 




































































Query Sequence  RSLIFRGAITGVDTSKEGLQFYEVVPVALVVAGTQMATGHRTMDTRLYFEGELIDAATNKPVIKVVRQG
Query Conservation    
 

 


 
            



 
      
 
     
 
  
 
  

 


 

  
   
Alig confidence 















....................


















.












Template Conservation 


 
  


  
 
 ....................




   


  
    
.
 

 

   
  
Template Sequence  DTLYTRTEVVGLRANS. . . . . . . . . . . . . . . . . . . . PKPGRAPTGLAGLRXTTID. RTDRLVLDFYRCA
Template Known Secondary structure 


....................

TTS


.TT

Template Predicted Secondary structure 


....................








.



Template SS confidence 




































































   107..110.........120.. .......130.........140. ........150....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions