Return to main results Retrieve Phyre Job Id

Job DescriptionP64451
Confidence3.54%DateThu Jan 5 12:08:26 GMT 2012
Rank36Aligned Residues54
% Identity4%Templatec1pn2D_
PDB info PDB header:lyaseChain: D: PDB Molecule:peroxisomal hydratase-dehydrogenase-epimerase; PDBTitle: crystal structure analysis of the selenomethionine labelled2 2-enoyl-coa hydratase 2 domain of candida tropicalis3 multifunctional enzyme type 2
Resolution1.95 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   106...110....... ..120.........130.........140.........150.........160.........170.........180...
Predicted Secondary structure 







..




























Query SS confidence 











. .

































































Query Sequence  AQRKPLVTTAGP. . RSLIFRGAITGVDTSKEGLQFYEVVPVALVVAGTQMATGHRTMDTRLYFEGELIDAATNKPVIKVV
Query Conservation       

  


..  
 

 


 
            



 
      
 
     
 
  
 
  

 


 

  
Alig confidence 











..

















..........................





















Template Conservation 

 
  





 
  
     
  
 


 
..........................  
           

 
 
  
Template Sequence  EHYLKVHSWPPPTEGEIKTTFEPIATTPKGTN. . . . . . . . . . . . . . . . . . . . . . . . . . VVIVHGSKSVDNKSGELIYSNE
Template Known Secondary structure  SSSS

SSTT..........................TTT

Template Predicted Secondary structure 













..........................





Template SS confidence 















































































   75....80.........90.........100...... ...110.........120........
 
   184.
Predicted Secondary structure 
Query SS confidence 

Query Sequence  RQ
Query Conservation    
Alig confidence 

Template Conservation 

Template Sequence  AT
Template Known Secondary structure 
Template Predicted Secondary structure 
Template SS confidence 

   129130
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions