Return to main results Retrieve Phyre Job Id

Job DescriptionP0A7A2
Confidence14.81%DateThu Jan 5 11:05:10 GMT 2012
Rank67Aligned Residues24
% Identity29%Templated2ejna1
SCOP infoUteroglobin-like Uteroglobin-like Uteroglobin-like
Resolution1.64

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   25....30.........40.........50......
Predicted Secondary structure 









Query SS confidence 































Query Sequence  DSPLTAKGEQQAMQVATRAKELGITHIISSDL
Query Conservation 
  

  
  

  
           
 


 
Alig confidence 














........








Template Conservation 
  





  
 

........
 

 

  
Template Sequence  DAKMTEEDKENALSL. . . . . . . . LDKIYTSPL
Template Known Secondary structure 

........TS
Template Predicted Secondary structure  ........



Template SS confidence 































   46...50.........60 .........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions