Return to main results Retrieve Phyre Job Id

Job DescriptionP30235
Confidence20.58%DateThu Jan 5 11:46:18 GMT 2012
Rank118Aligned Residues31
% Identity35%Templated1trba1
SCOP infoFAD/NAD(P)-binding domain FAD/NAD(P)-binding domain FAD/NAD-linked reductases, N-terminal and central domains
Resolution2.00

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   3......10.........20.........30.........40.........50.........60
Predicted Secondary structure 
























Query SS confidence 

























































Query Sequence  EKDYVVIIGSANIDVAGYSHESLNYADSNPGKIKFTPGGVGRNIAQNLALLGNKAWLL
Query Conservation     





   

                       

   
 
  

 

     
Alig confidence 









...........................




















Template Conservation     






...........................
 


 

  
   
  
 

Template Sequence  KHSKLLILGS. . . . . . . . . . . . . . . . . . . . . . . . . . . GPAGYTAAVYAARANLQPVLI
Template Known Secondary structure 

...........................STTT


Template Predicted Secondary structure 




...........................


Template SS confidence 

























































   4.....10... ......20.........30....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions