Return to main results Retrieve Phyre Job Id

Job DescriptionP30235
Confidence24.31%DateThu Jan 5 11:46:18 GMT 2012
Rank103Aligned Residues29
% Identity38%Templated1seza1
SCOP infoFAD/NAD(P)-binding domain FAD/NAD(P)-binding domain FAD-linked reductases, N-terminal domain
Resolution2.90

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   5....10.........20.........30.........40.........50.........60
Predicted Secondary structure 






















Query SS confidence 























































Query Sequence  DYVVIIGSANIDVAGYSHESLNYADSNPGKIKFTPGGVGRNIAQNLALLGNKAWLL
Query Conservation   





   

                       

   
 
  

 

     
Alig confidence 







...........................




















Template Conservation 


 



...........................
 


 

  

  
  
 

Template Sequence  KRVAVIGA. . . . . . . . . . . . . . . . . . . . . . . . . . . GVSGLAAAYKLKIHGLNVTVF
Template Known Secondary structure 


...........................STTS
Template Predicted Secondary structure 


...........................



Template SS confidence 























































   14.....20. ........30.........40..
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions