Return to main results Retrieve Phyre Job Id

Job DescriptionP30235
Confidence25.24%DateThu Jan 5 11:46:18 GMT 2012
Rank97Aligned Residues34
% Identity26%Templated1hdoa_
SCOP infoNAD(P)-binding Rossmann-fold domains NAD(P)-binding Rossmann-fold domains Tyrosine-dependent oxidoreductases
Resolution1.15

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   1........10.........20.........30.........40.........50.........60.
Predicted Secondary structure 


























Query SS confidence 




























































Query Sequence  MREKDYVVIIGSANIDVAGYSHESLNYADSNPGKIKFTPGGVGRNIAQNLALLGNKAWLLS
Query Conservation 
    





   

                       

   
 
  

 

     
 
Alig confidence 



.







..........................





















Template Conservation 
 

. 






..........................
 

  
   

  
  
    
Template Sequence  MAVK. KIAIFGAT. . . . . . . . . . . . . . . . . . . . . . . . . . GQTGLTTLAQAVQAGYEVTVLV
Template Known Secondary structure 



.STT..........................STT
Template Predicted Secondary structure 



.


..........................



Template SS confidence 




























































   1... .....10.. .......20.........30....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions