Return to main results Retrieve Phyre Job Id

Job DescriptionP30235
Confidence24.09%DateThu Jan 5 11:46:18 GMT 2012
Rank105Aligned Residues32
% Identity25%Templatec3nlcA_
PDB info PDB header:structural genomics, unknown functionChain: A: PDB Molecule:uncharacterized protein vp0956; PDBTitle: crystal structure of the vp0956 protein from vibrio parahaemolyticus.2 northeast structural genomics consortium target vpr147
Resolution2.15 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   2.......10.........20.........30.........40.........50.........60
Predicted Secondary structure 

























Query SS confidence 


























































Query Sequence  REKDYVVIIGSANIDVAGYSHESLNYADSNPGKIKFTPGGVGRNIAQNLALLGNKAWLL
Query Conservation      





   

                       

   
 
  

 

     
Alig confidence 










...........................




















Template Conservation        




...........................
 


 

  

  
  
 

Template Sequence  NLTERPIVIGF. . . . . . . . . . . . . . . . . . . . . . . . . . . GPCGLFAGLVLAQXGFNPIIV
Template Known Secondary structure  T






...........................STT


Template Predicted Secondary structure 






...........................




Template SS confidence 


























































   95....100..... ....110.........120......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions