Return to main results Retrieve Phyre Job Id

Job DescriptionP30235
Confidence63.66%DateThu Jan 5 11:46:18 GMT 2012
Rank69Aligned Residues33
% Identity39%Templatec3lzxB_
PDB info PDB header:oxidoreductaseChain: B: PDB Molecule:ferredoxin--nadp reductase 2; PDBTitle: crystal structure of ferredoxin-nadp+ oxidoreductase from bacillus2 subtilis (form ii)
Resolution1.90 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   1..... ...10.........20.........30.........40.........50.........60
Predicted Secondary structure 





...




















Query SS confidence 





. . .





















































Query Sequence  MREKDY. . . VVIIGSANIDVAGYSHESLNYADSNPGKIKFTPGGVGRNIAQNLALLGNKAWLL
Query Conservation 
    
...




   

                       

   
 
  

 

     
Alig confidence 





...




...........................





















Template Conservation 
      






...........................





 

  
   
  
 

Template Sequence  MREDTKVYDITIIG. . . . . . . . . . . . . . . . . . . . . . . . . . . GGPVGLFTAFYGGMRQASVKII
Template Known Secondary structure 

...........................
STT

Template Predicted Secondary structure 





...........................





Template SS confidence 






























































   1........10.... .....20.........30......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions