Return to main results Retrieve Phyre Job Id

Job DescriptionP30235
Confidence24.09%DateThu Jan 5 11:46:18 GMT 2012
Rank106Aligned Residues31
% Identity42%Templatec3lxdA_
PDB info PDB header:oxidoreductaseChain: A: PDB Molecule:fad-dependent pyridine nucleotide-disulphide PDBTitle: crystal structure of ferredoxin reductase arr from novosphingobium2 aromaticivorans
Resolution2.50 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   3......10.........20.........30.........40.........50.........60
Predicted Secondary structure 
























Query SS confidence 

























































Query Sequence  EKDYVVIIGSANIDVAGYSHESLNYADSNPGKIKFTPGGVGRNIAQNLALLGNKAWLL
Query Conservation     





   

                       

   
 
  

 

     
Alig confidence 








...........................





















Template Conservation   
 





...........................

 


 

  
   
    
 
Template Sequence  ERADVVIVG. . . . . . . . . . . . . . . . . . . . . . . . . . . AGHGGAQAAIALRQNGFEGRVL
Template Known Secondary structure 

...........................
STT

S
Template Predicted Secondary structure 




...........................






Template SS confidence 

























































   8.10...... ...20.........30........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions