Return to main results Retrieve Phyre Job Id

Job DescriptionP30235
Confidence33.21%DateThu Jan 5 11:46:18 GMT 2012
Rank86Aligned Residues31
% Identity45%Templatec3gucB_
PDB info PDB header:transferaseChain: B: PDB Molecule:ubiquitin-like modifier-activating enzyme 5; PDBTitle: human ubiquitin-activating enzyme 5 in complex with amppnp
Resolution2.25 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   3......10.........20.........30.........40.........50.........60
Predicted Secondary structure 
























Query SS confidence 

























































Query Sequence  EKDYVVIIGSANIDVAGYSHESLNYADSNPGKIKFTPGGVGRNIAQNLALLGNKAWLL
Query Conservation     





   

                       

   
 
  

 

     
Alig confidence 








...........................





















Template Conservation      




........................... 




 

  

  


 
 
Template Sequence  RTFAVAIVG. . . . . . . . . . . . . . . . . . . . . . . . . . . VGGVGSVTAEMLTRCGIGKLLL
Template Known Secondary structure  GG

...........................
STTT
S
Template Predicted Secondary structure 


...........................




Template SS confidence 

























































   72.......80 .........90.........100..
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions