Return to main results Retrieve Phyre Job Id

Job DescriptionP30235
Confidence30.73%DateThu Jan 5 11:46:18 GMT 2012
Rank91Aligned Residues34
% Identity32%Templatec3enkB_
PDB info PDB header:isomeraseChain: B: PDB Molecule:udp-glucose 4-epimerase; PDBTitle: 1.9a crystal structure of udp-glucose 4-epimerase from2 burkholderia pseudomallei
Resolution1.90 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   1........10.........20.........30.........40.........50.........60
Predicted Secondary structure 


























Query SS confidence 



























































Query Sequence  MREKDYVVIIGSANIDVAGYSHESLNYADSNPGKIKFTPGGVGRNIAQNLALLGNKAWLL
Query Conservation 
    





   

                       

   
 
  

 

     
Alig confidence 












..........................




















Template Conservation 

    






..........................



  

  

  
  
   
Template Sequence  MSTKGTILVTGGA. . . . . . . . . . . . . . . . . . . . . . . . . . GYIGSHTAVELLAHGYDVVIA
Template Known Secondary structure 

SS
TTT..........................STT
Template Predicted Secondary structure 







..........................



Template SS confidence 



























































   1........10... ......20.........30....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions