Return to main results Retrieve Phyre Job Id

Job DescriptionP30235
Confidence25.21%DateThu Jan 5 11:46:18 GMT 2012
Rank98Aligned Residues31
% Identity45%Templatec3d8xB_
PDB info PDB header:oxidoreductaseChain: B: PDB Molecule:thioredoxin reductase 1; PDBTitle: crystal structure of saccharomyces cerevisiae nadph dependent2 thioredoxin reductase 1
Resolution2.80 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   1........10.........20.........30.........40.........50.........60
Predicted Secondary structure 


























Query SS confidence 



























































Query Sequence  MREKDYVVIIGSANIDVAGYSHESLNYADSNPGKIKFTPGGVGRNIAQNLALLGNKAWLL
Query Conservation 
    





   

                       

   
 
  

 

     
Alig confidence 


..






...........................




















Template Conservation 
  ..






...........................
 


 

  
   
  
 

Template Sequence  VHN. . KVTIIGS. . . . . . . . . . . . . . . . . . . . . . . . . . . GPAAHTAAIYLARAEIKPILY
Template Known Secondary structure 
..

...........................STT


Template Predicted Secondary structure 


..


...........................




Template SS confidence 



























































   2.. .....10. ........20.........30..
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions