Return to main results Retrieve Phyre Job Id

Job DescriptionP30235
Confidence33.69%DateThu Jan 5 11:46:18 GMT 2012
Rank85Aligned Residues31
% Identity29%Templatec3allA_
PDB info PDB header:oxidoreductaseChain: A: PDB Molecule:2-methyl-3-hydroxypyridine-5-carboxylic acid oxygenase; PDBTitle: crystal structure of 2-methyl-3-hydroxypyridine-5-carboxylic acid2 oxygenase, mutant y270a
Resolution1.78 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   3......10.........20.........30.........40.........50.........60
Predicted Secondary structure 
























Query SS confidence 

























































Query Sequence  EKDYVVIIGSANIDVAGYSHESLNYADSNPGKIKFTPGGVGRNIAQNLALLGNKAWLL
Query Conservation     





   

                       

   
 
  

 

     
Alig confidence 








...........................





















Template Conservation     

 


...........................

 


  
  

  
  
 
 
Template Sequence  KTRRAEVAG. . . . . . . . . . . . . . . . . . . . . . . . . . . GGFAGLTAAIALKQNGWDVRLH
Template Known Secondary structure 



...........................
STT
Template Predicted Secondary structure 



...........................




Template SS confidence 

























































   10........ .20.........30.........40
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions